Lineage for d1rlw__ (1rlw -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.7: C2 domain-like [49561] (4 superfamilies) Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) 
Family b.7.1.1: PLC-like (P variant) [49563] (5 proteins) 
Protein Domain from cytosolic phospholipase A2 [49566] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49567] (3 PDB entries) 
Domain d1rlw__: 1rlw - [23177]
Details for d1rlw__
PDB Entry: 1rlw (more details), 2.4 Å
PDB Description: calcium-phospholipid binding domain from cytosolic phospholipase a2
SCOP Domain Sequences for d1rlw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlw__ b.7.1.1 (-) Domain from cytosolic phospholipase A2 {Human (Homo sapiens)}
sshkftvvvlratkvtkgafgdmldtpdpyvelfisttpdsrkrtrhfnndinpvwnetf
efildpnqenvleitlmdanyvmdetlgtatftvssmkvgekkevpfifnqvtemvlems
levass
SCOP Domain Coordinates for d1rlw__:
Click to download the PDB-style file with coordinates for d1rlw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rlw__:
- d1rlw__ appears in SCOP 1.57
- d1rlw__ appears in the current release, SCOPe 2.08, called d1rlwa_
View in 3D