Lineage for d3a8ia1 (3a8i A:1-276)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240991Fold d.250: Folate-binding domain [103024] (1 superfamily)
    duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands
  4. 2240992Superfamily d.250.1: Folate-binding domain [103025] (2 families) (S)
    some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase
  5. 2240993Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)
  6. 2241017Protein automated matches [231765] (1 species)
    not a true protein
  7. 2241018Species Escherichia coli K-12 [TaxId:83333] [231766] (3 PDB entries)
  8. 2241027Domain d3a8ia1: 3a8i A:1-276 [231767]
    Other proteins in same PDB: d3a8ia2, d3a8ib2, d3a8ic2, d3a8id2, d3a8ie_, d3a8if_
    automated match to d1vloa2
    complexed with c2f, po4

Details for d3a8ia1

PDB Entry: 3a8i (more details), 1.99 Å

PDB Description: Crystal Structure of ET-EHred-5-CH3-THF complex
PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a8ia1 d.250.1.1 (A:1-276) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfdvshmtivdlrgsr
treflryllandvakltksgkalysgmlnasggviddlivyyftedffrlvvnsatrekd
lswitqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqavegmkpffgvqagd
lfiattgytgeagyeialpnekaadfwralveagvkpcglgardtlrleagmnlygqemd
etisplaanmgwtiawepadrdfigrealevqrehg

SCOPe Domain Coordinates for d3a8ia1:

Click to download the PDB-style file with coordinates for d3a8ia1.
(The format of our PDB-style files is described here.)

Timeline for d3a8ia1: