SCOPe 2.06: Domain d3a8ia2: 3a8i A:277-363

Lineage for d3a8ia2 (3a8i A:277-363)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families)

5. Family b.44.2.0: automated matches [231768] (1 protein)
   not a true family

6. Protein automated matches [231769] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231770] (3 PDB entries)

8. Domain d3a8ia2: 3a8i A:277-363 [231771]
   Other proteins in same PDB: d3a8ia1, d3a8ib1, d3a8ic1, d3a8id1, d3a8ie_, d3a8if_
   automated match to d1vloa1
   complexed with c2f, po4

Details for d3a8ia2

PDB Entry: 3a8i, 1.99 Å

PDB Description: Crystal Structure of ET-EHred-5-CH3-THF complex

PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8ia2:

Sequence; same for both SEQRES and ATOM records:

>d3a8ia2 b.44.2.0 (A:277-363) automated matches {Escherichia coli K-12 [TaxId: 83333]}
teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget
aivqirnrempvkvtkpvfvrngkava

Timeline for d3a8ia2:

• d3a8ia2 first appeared in SCOPe 2.03
  
• d3a8ia2 appears in SCOPe 2.05
  
• d3a8ia2 appears in SCOPe 2.07
  
• d3a8ia2 appears in the current release, SCOPe 2.08