SCOPe 2.07: Domain d3a8ia1: 3a8i A:1-276

Lineage for d3a8ia1 (3a8i A:1-276)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.250: Folate-binding domain [103024] (1 superfamily)
   duplication: consists of two beta(2)-alpha-beta(3)-alpha subdomains swapped with the first strands

4. Superfamily d.250.1: Folate-binding domain [103025] (2 families)
   some topological similarity to Formylmethanofuran:tetrahydromethanopterin formyltransferase

5. Family d.250.1.1: Aminomethyltransferase folate-binding domain [103026] (4 proteins)

6. Protein automated matches [231765] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231766] (3 PDB entries)

8. Domain d3a8ia1: 3a8i A:1-276 [231767]
   Other proteins in same PDB: d3a8ia2, d3a8ib2, d3a8ic2, d3a8id2, d3a8ie_, d3a8if_
   automated match to d1vloa2
   complexed with c2f, po4

Details for d3a8ia1

PDB Entry: 3a8i, 1.99 Å

PDB Description: Crystal Structure of ET-EHred-5-CH3-THF complex

PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d3a8ia1:

Sequence; same for both SEQRES and ATOM records:

>d3a8ia1 d.250.1.1 (A:1-276) automated matches {Escherichia coli K-12 [TaxId: 83333]}
aqqtplyeqhtlcgarmvdfhgwmmplhygsqidehhavrtdagmfdvshmtivdlrgsr
treflryllandvakltksgkalysgmlnasggviddlivyyftedffrlvvnsatrekd
lswitqhaepfgieitvrddlsmiavqgpnaqakaatlfndaqrqavegmkpffgvqagd
lfiattgytgeagyeialpnekaadfwralveagvkpcglgardtlrleagmnlygqemd
etisplaanmgwtiawepadrdfigrealevqrehg

Timeline for d3a8ia1:

• d3a8ia1 first appeared in SCOPe 2.03
  
• d3a8ia1 appears in SCOPe 2.06
  
• d3a8ia1 appears in the current release, SCOPe 2.08