Lineage for d2wtfb1 (2wtf B:1-389)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1692262Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1692263Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1693621Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 1693725Protein automated matches [231300] (4 species)
    not a true protein
  7. 1693726Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231489] (6 PDB entries)
  8. 1693731Domain d2wtfb1: 2wtf B:1-389 [231493]
    Other proteins in same PDB: d2wtfa2, d2wtfb2
    automated match to d1jiha2
    protein/DNA complex; complexed with ca, cpt, dtp

Details for d2wtfb1

PDB Entry: 2wtf (more details), 2.5 Å

PDB Description: dna polymerase eta in complex with the cis-diammineplatinum (ii) 1,3-gtg intrastrand cross-link
PDB Compounds: (B:) DNA Polymerase ETA

SCOPe Domain Sequences for d2wtfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtfb1 e.8.1.7 (B:1-389) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalkifksacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr

SCOPe Domain Coordinates for d2wtfb1:

Click to download the PDB-style file with coordinates for d2wtfb1.
(The format of our PDB-style files is described here.)

Timeline for d2wtfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wtfb2