SCOPe 2.04: Domain d2wtfa2: 2wtf A:390-509

Lineage for d2wtfa2 (2wtf A:390-509)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries)

8. Domain d2wtfa2: 2wtf A:390-509 [231492]
   Other proteins in same PDB: d2wtfa1, d2wtfb1
   automated match to d1jiha1
   protein/DNA complex; complexed with ca, cpt, dtp

Details for d2wtfa2

PDB Entry: 2wtf, 2.5 Å

PDB Description: dna polymerase eta in complex with the cis-diammineplatinum (ii) 1,3-gtg intrastrand cross-link

PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d2wtfa2:

Sequence; same for both SEQRES and ATOM records:

>d2wtfa2 d.240.1.0 (A:390-509) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii

Timeline for d2wtfa2:

• d2wtfa2 first appeared in SCOPe 2.03
  
• d2wtfa2 appears in SCOPe 2.05
  
• d2wtfa2 appears in the current release, SCOPe 2.08