SCOPe 2.08: Domain d2wlkb1: 2wlk B:11-138

Lineage for d2wlkb1 (2wlk B:11-138)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries)
   Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690

8. Domain d2wlkb1: 2wlk B:11-138 [231443]
   Other proteins in same PDB: d2wlka2, d2wlka3, d2wlkb2, d2wlkb3
   automated match to d1xl4a2
   complexed with cl, k, spm

Details for d2wlkb1

PDB Entry: 2wlk, 2.8 Å

PDB Description: structure of the atp-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (B:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2wlkb1:

Sequence; same for both SEQRES and ATOM records:

>d2wlkb1 f.14.1.1 (B:11-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
kprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalayla
cgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasl
iyarftrp

Timeline for d2wlkb1:

• d2wlkb1 first appeared in SCOPe 2.03
  
• d2wlkb1 appears in SCOPe 2.07