SCOPe 2.08: Domain d2wlka2: 2wlk A:139-295

Lineage for d2wlka2 (2wlk A:139-295)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein Inward rectifier potassium channel kirbac3.1 [117047] (1 species)

7. Species Magnetospirillum magnetotacticum [TaxId:188] [117048] (4 PDB entries)
   Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690

8. Domain d2wlka2: 2wlk A:139-295 [231447]
   Other proteins in same PDB: d2wlka1, d2wlka3, d2wlkb1, d2wlkb3
   automated match to d1xl4a1
   complexed with cl, k, spm

Details for d2wlka2

PDB Entry: 2wlk, 2.8 Å

PDB Description: structure of the atp-sensitive inward rectifier potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d2wlka2:

Sequence; same for both SEQRES and ATOM records:

>d2wlka2 b.1.18.16 (A:139-295) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheiaq

Timeline for d2wlka2:

• d2wlka2 first appeared in SCOPe 2.03
  
• d2wlka2 appears in SCOPe 2.07