![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Inward rectifier potassium channel kirbac3.1 [118227] (1 species) |
![]() | Species Magnetospirillum magnetotacticum [TaxId:188] [118228] (4 PDB entries) Uniprot Q8YY97 # 46% sequence identity; Anabaena sp. PCC 7120 TaxID: 103690 |
![]() | Domain d1xl4a2: 1xl4 A:23-138 [115431] Other proteins in same PDB: d1xl4a1, d1xl4a3, d1xl4b1, d1xl4b3 complexed with k, mg |
PDB Entry: 1xl4 (more details), 2.6 Å
SCOPe Domain Sequences for d1xl4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp
Timeline for d1xl4a2: