Lineage for d2r9ud_ (2r9u D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1584080Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1584081Protein automated matches [190787] (7 species)
    not a true protein
  7. 1584124Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (5 PDB entries)
  8. 1584129Domain d2r9ud_: 2r9u D: [231250]
    automated match to d2o6ra_

Details for d2r9ud_

PDB Entry: 2r9u (more details), 2.1 Å

PDB Description: Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain
PDB Compounds: (D:) Variable lymphocyte receptor

SCOPe Domain Sequences for d2r9ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9ud_ c.10.2.0 (D:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
hhsagcpsqcscdqtlvncqnirlasvpagiptdkqrlwlnnnqitklepgvfdhlvnlq
qlyfnsnkltaiptgvfdkltqltqldlndnhlksiprgafdnlkslthiylynnpwdce
crdimylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc

SCOPe Domain Coordinates for d2r9ud_:

Click to download the PDB-style file with coordinates for d2r9ud_.
(The format of our PDB-style files is described here.)

Timeline for d2r9ud_: