Lineage for d2r9ud1 (2r9u D:22-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2852008Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (18 PDB entries)
  8. 2852031Domain d2r9ud1: 2r9u D:22-190 [231250]
    Other proteins in same PDB: d2r9ua2, d2r9ub2, d2r9uc2, d2r9ud2
    automated match to d2o6ra_

Details for d2r9ud1

PDB Entry: 2r9u (more details), 2.1 Å

PDB Description: Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain
PDB Compounds: (D:) Variable lymphocyte receptor

SCOPe Domain Sequences for d2r9ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r9ud1 c.10.2.0 (D:22-190) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
cpsqcscdqtlvncqnirlasvpagiptdkqrlwlnnnqitklepgvfdhlvnlqqlyfn
snkltaiptgvfdkltqltqldlndnhlksiprgafdnlkslthiylynnpwdcecrdim
ylrnwvadhtsivmrwdgkavndpdsakcagtntpvravteastspskc

SCOPe Domain Coordinates for d2r9ud1:

Click to download the PDB-style file with coordinates for d2r9ud1.
(The format of our PDB-style files is described here.)

Timeline for d2r9ud1: