Lineage for d2r5aa2 (2r5a A:282-385)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784802Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2784803Protein automated matches [191144] (3 species)
    not a true protein
  7. 2784806Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (5 PDB entries)
  8. 2784817Domain d2r5aa2: 2r5a A:282-385 [231245]
    Other proteins in same PDB: d2r5aa3
    automated match to d1oi1a2
    complexed with mlz

Details for d2r5aa2

PDB Entry: 2r5a (more details), 2.3 Å

PDB Description: crystal structure of the two mbt repeats from sex-comb on midleg (scm) in complex with methyl lysine
PDB Compounds: (A:) Polycomb protein Scm

SCOPe Domain Sequences for d2r5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r5aa2 b.34.9.0 (A:282-385) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
swpgylckilnnamvapeeifqpeppepeenlfkvgqkleavdkknpqliccatvdaikd
dqihvtfdgwrgafdywcnyrsrdifpagwcarschpmqppghk

SCOPe Domain Coordinates for d2r5aa2:

Click to download the PDB-style file with coordinates for d2r5aa2.
(The format of our PDB-style files is described here.)

Timeline for d2r5aa2: