| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231239] (5 PDB entries) |
| Domain d2r5aa2: 2r5a A:282-385 [231245] Other proteins in same PDB: d2r5aa3 automated match to d1oi1a2 complexed with mlz |
PDB Entry: 2r5a (more details), 2.3 Å
SCOPe Domain Sequences for d2r5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r5aa2 b.34.9.0 (A:282-385) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
swpgylckilnnamvapeeifqpeppepeenlfkvgqkleavdkknpqliccatvdaikd
dqihvtfdgwrgafdywcnyrsrdifpagwcarschpmqppghk
Timeline for d2r5aa2: