SCOPe 2.08: Domain d2p5vf2: 2p5v F:66-158

Lineage for d2p5vf2 (2p5v F:66-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries)

8. Domain d2p5vf2: 2p5v F:66-158 [231133]
   Other proteins in same PDB: d2p5va1, d2p5vb1, d2p5vc1, d2p5vd1, d2p5ve1, d2p5vf1, d2p5vg1, d2p5vh1
   automated match to d2cyya2
   complexed with ca, cl, gol

Details for d2p5vf2

PDB Entry: 2p5v, 1.99 Å

PDB Description: Crystal Structure of Transcriptional Regulator NMB0573 from Neisseria Meningitidis

PDB Compounds: (F:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p5vf2:

Sequence; same for both SEQRES and ATOM records:

>d2p5vf2 d.58.4.0 (F:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhll

Timeline for d2p5vf2:

• d2p5vf2 first appeared in SCOPe 2.03
  
• d2p5vf2 appears in SCOPe 2.07