SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p5ve2 (2p5v E:66-158)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172847Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2173213Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2173214Protein automated matches [190081] (23 species)
    not a true protein
  7. 2173300Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries)
  8. 2173304Domain d2p5ve2: 2p5v E:66-158 [231131]
    Other proteins in same PDB: d2p5va1, d2p5vb1, d2p5vc1, d2p5vd1, d2p5ve1, d2p5vf1, d2p5vg1, d2p5vh1
    automated match to d2cyya2
    complexed with ca, cl, gol

Details for d2p5ve2

PDB Entry: 2p5v (more details), 1.99 Å

PDB Description: Crystal Structure of Transcriptional Regulator NMB0573 from Neisseria Meningitidis
PDB Compounds: (E:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p5ve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5ve2 d.58.4.0 (E:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhll

SCOPe Domain Coordinates for d2p5ve2:

Click to download the PDB-style file with coordinates for d2p5ve2.
(The format of our PDB-style files is described here.)

Timeline for d2p5ve2: