![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122586] [231118] (3 PDB entries) |
![]() | Domain d2p5va1: 2p5v A:3-65 [231122] Other proteins in same PDB: d2p5va2, d2p5vb2, d2p5vc2, d2p5vd2, d2p5ve2, d2p5vf2, d2p5vg2, d2p5vh2 automated match to d2cyya1 complexed with ca, cl, gol |
PDB Entry: 2p5v (more details), 1.99 Å
SCOPe Domain Sequences for d2p5va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5va1 a.4.5.0 (A:3-65) automated matches {Neisseria meningitidis [TaxId: 122586]} qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe svn
Timeline for d2p5va1: