SCOPe 2.08: Domain d2huzb_: 2huz B:

Lineage for d2huzb_ (2huz B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)

8. Domain d2huzb_: 2huz B: [230776]
   automated match to d4ag7a_

Details for d2huzb_

PDB Entry: 2huz, 2.67 Å

PDB Description: Crystal structure of GNPNAT1

PDB Compounds: (B:) Glucosamine 6-phosphate N-acetyltransferase

SCOPe Domain Sequences for d2huzb_:

Sequence; same for both SEQRES and ATOM records:

>d2huzb_ d.108.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlte
tgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrvedv
vvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrrf
lk

Timeline for d2huzb_:

• d2huzb_ first appeared in SCOPe 2.03
  
• d2huzb_ appears in SCOPe 2.07