Lineage for d2nrd_1 (2nrd 8-166)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.3: Multidomain cupredoxins [49550] (4 proteins) Protein Nitrite reductase, NIR [49551] (3 species) Species Achromobacter cycloclastes [TaxId:223] [49552] (7 PDB entries) 
Domain d2nrd_1: 2nrd 8-166 [23056]
Details for d2nrd_1
PDB Entry: 2nrd (more details), 2.1 Å
PDB Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type ii cu depleted
SCOP Domain Sequences for d2nrd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nrd_1 b.6.1.3 (8-166) Nitrite reductase, NIR {Achromobacter cycloclastes}
distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
SCOP Domain Coordinates for d2nrd_1:
Click to download the PDB-style file with coordinates for d2nrd_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nrd_1:
- d2nrd_1 appears in SCOP 1.57
- d2nrd_1 appears in the current release, SCOPe 2.08, called d2nrda1
View in 3D
