Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [230409] (3 PDB entries) |
Domain d1yb4a1: 1yb4 A:1-160 [230410] Other proteins in same PDB: d1yb4a2, d1yb4b2 automated match to d1vpda2 |
PDB Entry: 1yb4 (more details), 2.4 Å
SCOPe Domain Sequences for d1yb4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yb4a1 c.2.1.0 (A:1-160) automated matches {Salmonella typhimurium [TaxId: 99287]} mklgfiglgimgspmainlaraghqlhvttigpvadellslgavnvetarqvtefadiif imvpdtpqvedvlfgehgcaktslqgktivdmssispietkrfaqrvnemgadyldapvs ggeigaregtlsimvggeqkvfdrvkplfdilgknitlvg
Timeline for d1yb4a1: