Lineage for d1yb4b2 (1yb4 B:161-291)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721936Species Salmonella typhimurium [TaxId:99287] [230411] (1 PDB entry)
  8. 2721938Domain d1yb4b2: 1yb4 B:161-291 [230414]
    Other proteins in same PDB: d1yb4a1, d1yb4b1
    automated match to d1vpda1

Details for d1yb4b2

PDB Entry: 1yb4 (more details), 2.4 Å

PDB Description: Crystal Structure of the Tartronic Semialdehyde Reductase from Salmonella typhimurium LT2
PDB Compounds: (B:) tartronic semialdehyde reductase

SCOPe Domain Sequences for d1yb4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yb4b2 a.100.1.0 (B:161-291) automated matches {Salmonella typhimurium [TaxId: 99287]}
gngdgqtckvanqiivalnieavsealvfaskagadpvrvrqalmggfassrilevhger
minrtfepgfkialhqkdlnlalqsakalalnlpntatcqelfntcaanggsqldhsamv
qalelmanhkl

SCOPe Domain Coordinates for d1yb4b2:

Click to download the PDB-style file with coordinates for d1yb4b2.
(The format of our PDB-style files is described here.)

Timeline for d1yb4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yb4b1