PDB entry 1yb4

View 1yb4 on RCSB PDB site
Description: Crystal Structure of the Tartronic Semialdehyde Reductase from Salmonella typhimurium LT2
Class: oxidoreductase
Keywords: Structural Genomics, Tartronic Semialdehyde Reductase, Oxidoreductase, Salmonella typhimurium LT2, PSI, Protein Structure Initiative, The Midwest Center for Structural Genomics, MCSG
Deposited on 2004-12-20, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.229
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tartronic semialdehyde reductase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZR83 (3-End)
      • modified residue (3)
      • modified residue (13)
      • modified residue (17)
      • modified residue (64)
      • modified residue (94)
      • modified residue (112)
      • modified residue (136)
      • modified residue (207)
      • modified residue (223)
      • modified residue (281)
      • modified residue (288)
    Domains in SCOPe 2.07: d1yb4a1, d1yb4a2
  • Chain 'B':
    Compound: tartronic semialdehyde reductase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZR83 (3-End)
      • modified residue (3)
      • modified residue (13)
      • modified residue (17)
      • modified residue (64)
      • modified residue (94)
      • modified residue (112)
      • modified residue (136)
      • modified residue (207)
      • modified residue (223)
      • modified residue (281)
      • modified residue (288)
    Domains in SCOPe 2.07: d1yb4b1, d1yb4b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yb4A (A:)
    snamklgfiglgimgspmainlaraghqlhvttigpvadellslgavnvetarqvtefad
    iifimvpdtpqvedvlfgehgcaktslqgktivdmssispietkrfaqrvnemgadylda
    pvsggeigaregtlsimvggeqkvfdrvkplfdilgknitlvggngdgqtckvanqiiva
    lnieavsealvfaskagadpvrvrqalmggfassrilevhgerminrtfepgfkialhqk
    dlnlalqsakalalnlpntatcqelfntcaanggsqldhsamvqalelmanhkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yb4A (A:)
    mklgfiglgimgspmainlaraghqlhvttigpvadellslgavnvetarqvtefadiif
    imvpdtpqvedvlfgehgcaktslqgktivdmssispietkrfaqrvnemgadyldapvs
    ggeigaregtlsimvggeqkvfdrvkplfdilgknitlvggngdgqtckvanqiivalni
    eavsealvfaskagadpvrvrqalmggfassrilevhgerminrtfepgfkialhqkdln
    lalqsakalalnlpntatcqelfntcaanggsqldhsamvqalelmanhkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yb4B (B:)
    snamklgfiglgimgspmainlaraghqlhvttigpvadellslgavnvetarqvtefad
    iifimvpdtpqvedvlfgehgcaktslqgktivdmssispietkrfaqrvnemgadylda
    pvsggeigaregtlsimvggeqkvfdrvkplfdilgknitlvggngdgqtckvanqiiva
    lnieavsealvfaskagadpvrvrqalmggfassrilevhgerminrtfepgfkialhqk
    dlnlalqsakalalnlpntatcqelfntcaanggsqldhsamvqalelmanhkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yb4B (B:)
    mklgfiglgimgspmainlaraghqlhvttigpvadellslgavnvetarqvtefadiif
    imvpdtpqvedvlfgehgcaktslqgktivdmssispietkrfaqrvnemgadyldapvs
    ggeigaregtlsimvggeqkvfdrvkplfdilgknitlvggngdgqtckvanqiivalni
    eavsealvfaskagadpvrvrqalmggfassrilevhgerminrtfepgfkialhqkdln
    lalqsakalalnlpntatcqelfntcaanggsqldhsamvqalelmanhkl