![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.0: automated matches [191378] (1 protein) not a true family |
![]() | Protein automated matches [190463] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries) |
![]() | Domain d1w4rf2: 1w4r F:151-191 [230365] Other proteins in same PDB: d1w4ra1, d1w4rb1, d1w4rc1, d1w4rd1, d1w4re1, d1w4rf1, d1w4rg1, d1w4rh1 automated match to d1xbta2 complexed with dtu, ttp, zn |
PDB Entry: 1w4r (more details), 1.83 Å
SCOPe Domain Sequences for d1w4rf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w4rf2 g.39.1.0 (F:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]} avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk
Timeline for d1w4rf2: