SCOPe 2.08: Domain d1w4rb1: 1w4r B:18-150

Lineage for d1w4rb1 (1w4r B:18-150)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
   N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)

6. Protein automated matches [230352] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230353] (2 PDB entries)

8. Domain d1w4rb1: 1w4r B:18-150 [230354]
   Other proteins in same PDB: d1w4ra2, d1w4rb2, d1w4rc2, d1w4rd2, d1w4re2, d1w4rf2, d1w4rg2, d1w4rh2
   automated match to d1xbta1
   complexed with dtu, ttp, zn

Details for d1w4rb1

PDB Entry: 1w4r, 1.83 Å

PDB Description: Structure of a type II thymidine kinase with bound dTTP

PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1w4rb1:

Sequence, based on SEQRES records:

>d1w4rb1 c.37.1.24 (B:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt

Sequence, based on observed residues (ATOM records):

>d1w4rb1 c.37.1.24 (B:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfmealpacllrdv
aqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplae
svvklt

Timeline for d1w4rb1:

• d1w4rb1 first appeared in SCOPe 2.03
  
• d1w4rb1 appears in SCOPe 2.07