SCOPe 2.07: Domain d4npbb2: 4npb B:82-235

Lineage for d4npbb2 (4npb B:82-235)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
   elaborated common fold

6. Protein automated matches [228323] (3 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [230169] (1 PDB entry)

8. Domain d4npbb2: 4npb B:82-235 [230170]
   Other proteins in same PDB: d4npba1, d4npba3, d4npbb1, d4npbb3
   automated match to d1eeja1
   complexed with po4, suc

Details for d4npbb2

PDB Entry: 4npb, 2.15 Å

PDB Description: the crystal structure of thiol:disulfide interchange protein dsbc from yersinia pestis co92

PDB Compounds: (B:) Protein disulfide isomerase II

SCOPe Domain Sequences for d4npbb2:

Sequence; same for both SEQRES and ATOM records:

>d4npbb2 c.47.1.9 (B:82-235) automated matches {Yersinia pestis [TaxId: 214092]}
nvtnqallkklealssemivykapeekhvitvftditcgycrklheqmkdynalgitvry
lafprqglssqaekdmrsiwcmadrnkafddamknndispatcktdiskhyqlgvqfgiq
gtpaivlqngtivpgyqgpkemlqmlnahqaslk

Timeline for d4npbb2:

• d4npbb2 first appeared in SCOPe 2.03
  
• d4npbb2 appears in SCOPe 2.06
  
• d4npbb2 appears in the current release, SCOPe 2.08