![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) ![]() |
![]() | Family d.17.3.0: automated matches [228319] (1 protein) not a true family |
![]() | Protein automated matches [228320] (3 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [230167] (1 PDB entry) |
![]() | Domain d4npbb1: 4npb B:22-81 [230168] Other proteins in same PDB: d4npba2, d4npba3, d4npbb2, d4npbb3 automated match to d1eeja2 complexed with po4, suc |
PDB Entry: 4npb (more details), 2.15 Å
SCOPe Domain Sequences for d4npbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4npbb1 d.17.3.0 (B:22-81) automated matches {Yersinia pestis [TaxId: 214092]} ddsaiqqtlkkldiqqadiqpspipgistvmtesgvlyisadgkhllqgplydvsgdqpi
Timeline for d4npbb1: