SCOP 1.63: Domain d1cuoa_: 1cuo A:

Lineage for d1cuoa_ (1cuo A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Methylomonas sp. j [TaxId:32038] [49536] (1 PDB entry)

8. Domain d1cuoa_: 1cuo A: [23015]
   complexed with cu

Details for d1cuoa_

PDB Entry: 1cuo, 1.6 Å

PDB Description: crystal structure analysis of isomer-2 azurin from methylomonas j

SCOP Domain Sequences for d1cuoa_:

Sequence; same for both SEQRES and ATOM records:

>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j}
ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
mrgtlklee

Timeline for d1cuoa_:

• d1cuoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cuoa_ appears in SCOP 1.61
  
• d1cuoa_ appears in SCOP 1.65
  
• d1cuoa_ appears in the current release, SCOPe 2.08