Lineage for d1cuoa_ (1cuo A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 10917Protein Azurin [49530] (6 species)
  7. 10944Species Methylomonas sp. j [TaxId:32038] [49536] (1 PDB entry)
  8. 10945Domain d1cuoa_: 1cuo A: [23015]

Details for d1cuoa_

PDB Entry: 1cuo (more details), 1.6 Å

PDB Description: crystal structure analysis of isomer-2 azurin from methylomonas j

SCOP Domain Sequences for d1cuoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j}
ascettvtsgdtmtystrsisvpascaeftvnfehkghmpktgmghnwvlaksadvgdva
kegahagadnnfvtpgdkrviaftpiigggektsvkfkvsalskdeaytyfcsypghfsm
mrgtlklee

SCOP Domain Coordinates for d1cuoa_:

Click to download the PDB-style file with coordinates for d1cuoa_.
(The format of our PDB-style files is described here.)

Timeline for d1cuoa_: