SCOPe 2.08: Domain d4l3cn_: 4l3c N:

Lineage for d4l3cn_ (4l3c N:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d4l3cn_: 4l3c N: [230104]
   Other proteins in same PDB: d4l3ca1, d4l3ca2, d4l3cc1, d4l3cc2, d4l3ce1, d4l3ce2, d4l3cg1, d4l3cg2, d4l3ci1, d4l3ci2, d4l3ck1, d4l3ck2, d4l3cm1, d4l3cm2, d4l3co1, d4l3co2, d4l3cq1, d4l3cq2, d4l3cs1, d4l3cs2, d4l3cu1, d4l3cu2, d4l3cw1, d4l3cw2, d4l3cy1, d4l3cy2
   automated match to d4fxla_
   complexed with cl, gol; mutant

Details for d4l3cn_

PDB Entry: 4l3c, 2.64 Å

PDB Description: Structure of HLA-A2 in complex with D76N b2m mutant and NY-ESO1 double mutant

PDB Compounds: (N:) Beta-2-microglobulin

SCOPe Domain Sequences for d4l3cn_:

Sequence; same for both SEQRES and ATOM records:

>d4l3cn_ b.1.1.2 (N:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekneyacrvnhvtlsqpkivkwdrdm

Timeline for d4l3cn_:

• d4l3cn_ first appeared in SCOPe 2.03
  
• d4l3cn_ appears in SCOPe 2.07