Lineage for d4l3co2 (4l3c O:182-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2747075Domain d4l3co2: 4l3c O:182-276 [230115]
    Other proteins in same PDB: d4l3ca1, d4l3cb_, d4l3cc1, d4l3cd_, d4l3ce1, d4l3cf_, d4l3cg1, d4l3ch_, d4l3ci1, d4l3cj_, d4l3ck1, d4l3cl_, d4l3cm1, d4l3cn_, d4l3co1, d4l3cp_, d4l3cq1, d4l3cr_, d4l3cs1, d4l3ct_, d4l3cu1, d4l3cv_, d4l3cw1, d4l3cx_, d4l3cy1, d4l3cz_
    automated match to d1ogaa1
    complexed with cl, gol; mutant

Details for d4l3co2

PDB Entry: 4l3c (more details), 2.64 Å

PDB Description: Structure of HLA-A2 in complex with D76N b2m mutant and NY-ESO1 double mutant
PDB Compounds: (O:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l3co2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l3co2 b.1.1.2 (O:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d4l3co2:

Click to download the PDB-style file with coordinates for d4l3co2.
(The format of our PDB-style files is described here.)

Timeline for d4l3co2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l3co1