| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
| Domain d4l3ct_: 4l3c T: [230105] Other proteins in same PDB: d4l3ca1, d4l3ca2, d4l3cc1, d4l3cc2, d4l3ce1, d4l3ce2, d4l3cg1, d4l3cg2, d4l3ci1, d4l3ci2, d4l3ck1, d4l3ck2, d4l3cm1, d4l3cm2, d4l3co1, d4l3co2, d4l3cq1, d4l3cq2, d4l3cs1, d4l3cs2, d4l3cu1, d4l3cu2, d4l3cw1, d4l3cw2, d4l3cy1, d4l3cy2 automated match to d4fxla_ complexed with cl, gol; mutant |
PDB Entry: 4l3c (more details), 2.64 Å
SCOPe Domain Sequences for d4l3ct_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l3ct_ b.1.1.2 (T:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekneyacrvnhvtlsqpkivkwdrdm
Timeline for d4l3ct_:
View in 3DDomains from other chains: (mouse over for more information) d4l3ca1, d4l3ca2, d4l3cb_, d4l3cc1, d4l3cc2, d4l3cd_, d4l3ce1, d4l3ce2, d4l3cf_, d4l3cg1, d4l3cg2, d4l3ch_, d4l3ci1, d4l3ci2, d4l3cj_, d4l3ck1, d4l3ck2, d4l3cl_, d4l3cm1, d4l3cm2, d4l3cn_, d4l3co1, d4l3co2, d4l3cp_, d4l3cq1, d4l3cq2, d4l3cr_, d4l3cs1, d4l3cs2, d4l3cu1, d4l3cu2, d4l3cv_, d4l3cw1, d4l3cw2, d4l3cx_, d4l3cy1, d4l3cy2, d4l3cz_ |