Lineage for d4l3cp_ (4l3c P:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2745653Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2746208Domain d4l3cp_: 4l3c P: [230102]
    Other proteins in same PDB: d4l3ca1, d4l3ca2, d4l3cc1, d4l3cc2, d4l3ce1, d4l3ce2, d4l3cg1, d4l3cg2, d4l3ci1, d4l3ci2, d4l3ck1, d4l3ck2, d4l3cm1, d4l3cm2, d4l3co1, d4l3co2, d4l3cq1, d4l3cq2, d4l3cs1, d4l3cs2, d4l3cu1, d4l3cu2, d4l3cw1, d4l3cw2, d4l3cy1, d4l3cy2
    automated match to d4fxla_
    complexed with cl, gol; mutant

Details for d4l3cp_

PDB Entry: 4l3c (more details), 2.64 Å

PDB Description: Structure of HLA-A2 in complex with D76N b2m mutant and NY-ESO1 double mutant
PDB Compounds: (P:) Beta-2-microglobulin

SCOPe Domain Sequences for d4l3cp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l3cp_ b.1.1.2 (P:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekneyacrvnhvtlsqpkivkwdrdm

SCOPe Domain Coordinates for d4l3cp_:

Click to download the PDB-style file with coordinates for d4l3cp_.
(The format of our PDB-style files is described here.)

Timeline for d4l3cp_: