![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins) contains two additional beta-strands in the N-terminal extension |
![]() | Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [54643] (4 PDB entries) |
![]() | Domain d4kehb_: 4keh B: [230070] Other proteins in same PDB: d4kehc_, d4kehd_ automated match to d1mkaa_ complexed with 1r3 |
PDB Entry: 4keh (more details), 1.9 Å
SCOPe Domain Sequences for d4kehb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kehb_ d.38.1.2 (B:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]} kresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldinp dlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlptak kvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfqd
Timeline for d4kehb_: