| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein Acyl carrier protein [47338] (7 species) |
| Species Escherichia coli [TaxId:562] [47339] (26 PDB entries) Uniprot P02901 |
| Domain d4kehc_: 4keh C: [230071] Other proteins in same PDB: d4keha_, d4kehb_ automated match to d1t8ka_ complexed with 1r3 |
PDB Entry: 4keh (more details), 1.9 Å
SCOPe Domain Sequences for d4kehc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kehc_ a.28.1.1 (C:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa
Timeline for d4kehc_: