Lineage for d4keha_ (4keh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943682Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2943683Protein beta-Hydroxydecanol thiol ester dehydrase [54642] (1 species)
  7. 2943684Species Escherichia coli [TaxId:562] [54643] (4 PDB entries)
  8. 2943689Domain d4keha_: 4keh A: [230067]
    Other proteins in same PDB: d4kehc_, d4kehd_
    automated match to d1mkaa_
    complexed with 1r3

Details for d4keha_

PDB Entry: 4keh (more details), 1.9 Å

PDB Description: Crosslinked Crystal Structure of Type II Fatty Synthase Dehydratase, FabA, and Acyl Carrier Protein, AcpP
PDB Compounds: (A:) n-{3-[dihydroxy(nonyl)-lambda~4~-sulfanyl]propyl}-n~3~-[(2r)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alaninamide

SCOPe Domain Sequences for d4keha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4keha_ d.38.1.2 (A:) beta-Hydroxydecanol thiol ester dehydrase {Escherichia coli [TaxId: 562]}
vdkresytkedllasgrgelfgakgpqlpapnmlmmdrvvkmtetggnfdkgyveaeldi
npdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlpt
akkvtyrihfkrivnrrlimgladgevlvdgrliytasdlkvglfq

SCOPe Domain Coordinates for d4keha_:

Click to download the PDB-style file with coordinates for d4keha_.
(The format of our PDB-style files is described here.)

Timeline for d4keha_: