Lineage for d4kehd_ (4keh D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706115Protein Acyl carrier protein [47338] (7 species)
  7. 2706121Species Escherichia coli [TaxId:562] [47339] (26 PDB entries)
    Uniprot P02901
  8. 2706133Domain d4kehd_: 4keh D: [230068]
    Other proteins in same PDB: d4keha_, d4kehb_
    automated match to d1t8ka_
    complexed with 1r3

Details for d4kehd_

PDB Entry: 4keh (more details), 1.9 Å

PDB Description: Crosslinked Crystal Structure of Type II Fatty Synthase Dehydratase, FabA, and Acyl Carrier Protein, AcpP
PDB Compounds: (D:) Acyl carrier protein

SCOPe Domain Sequences for d4kehd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kehd_ a.28.1.1 (D:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d4kehd_:

Click to download the PDB-style file with coordinates for d4kehd_.
(The format of our PDB-style files is described here.)

Timeline for d4kehd_: