![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
![]() | Domain d4cfwb2: 4cfw B:310-432 [229791] Other proteins in same PDB: d4cfwa1, d4cfwa2, d4cfwc1, d4cfwc2 automated match to d1h1pb2 complexed with sq9 |
PDB Entry: 4cfw (more details), 2.45 Å
SCOPe Domain Sequences for d4cfwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cfwb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d4cfwb2: