![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
![]() | Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
![]() | Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species) |
![]() | Species Salmonella typhimurium [TaxId:99287] [229690] (1 PDB entry) |
![]() | Domain d4mgha3: 4mgh A:221-429 [229691] Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha4, d4mgha6, d4mgha7 automated match to d3ujna3 complexed with act, adp, mg, mn, so4, xe |
PDB Entry: 4mgh (more details), 2.65 Å
SCOPe Domain Sequences for d4mgha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mgha3 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 99287]} ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn geelrgyhkpimlaggigniradhvqkge
Timeline for d4mgha3: