Lineage for d4mgha6 (4mgh A:817-1033)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928072Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 1928073Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 1928074Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)
  6. 1928084Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species)
  7. 1928093Species Salmonella typhimurium [TaxId:99287] [229692] (1 PDB entry)
  8. 1928095Domain d4mgha6: 4mgh A:817-1033 [229695]
    Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha3, d4mgha5, d4mgha7
    automated match to d3ujna6
    complexed with act, adp, mg, mn, so4, xe

Details for d4mgha6

PDB Entry: 4mgh (more details), 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis
PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha6:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mgha6 d.139.1.1 (A:817-1033) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 99287]}
pqlstednalllidlgkghnalgatalaqvyrqlgdkpadvrdvaqlkgfydamqalvaa
rkllawhdrsdggllvtlaemafaghcgvqvdiaalgddhlaalfneelggviqvraedr
daveallaqygladcvhylgqalagdrfvitandqtvfsesrttlrvwwaettwqmqrlr
dnpqcadqeheakandtdpglnvklsfdinediaapy

SCOPe Domain Coordinates for d4mgha6:

Click to download the PDB-style file with coordinates for d4mgha6.
(The format of our PDB-style files is described here.)

Timeline for d4mgha6: