SCOPe 2.05: Domain d4mgha5: 4mgh A:617-816

Lineage for d4mgha5 (4mgh A:617-816)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)

7. Species Salmonella typhimurium [TaxId:99287] [229690] (1 PDB entry)

8. Domain d4mgha5: 4mgh A:617-816 [229694]
   Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha4, d4mgha6, d4mgha7
   automated match to d3ujna5
   complexed with act, adp, mg, mn, so4, xe

Details for d4mgha5

PDB Entry: 4mgh, 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha5:

Sequence; same for both SEQRES and ATOM records:

>d4mgha5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 99287]}
qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp
vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl
sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneqremts
plslvisafarvedvrhtlt

Timeline for d4mgha5:

• d4mgha5 first appeared in SCOPe 2.03
  
• d4mgha5 appears in SCOPe 2.04
  
• d4mgha5 appears in SCOPe 2.06
  
• d4mgha5 appears in the current release, SCOPe 2.08