Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) |
Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species) |
Species Salmonella typhimurium [TaxId:99287] [229690] (1 PDB entry) |
Domain d4mgha5: 4mgh A:617-816 [229694] Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha4, d4mgha6, d4mgha7 automated match to d3ujna5 complexed with act, adp, mg, mn, so4, xe |
PDB Entry: 4mgh (more details), 2.65 Å
SCOPe Domain Sequences for d4mgha5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mgha5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium [TaxId: 99287]} qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneqremts plslvisafarvedvrhtlt
Timeline for d4mgha5: