Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species) |
Species Salmonella typhimurium [TaxId:99287] [229692] (1 PDB entry) |
Domain d4mgha4: 4mgh A:430-616 [229693] Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha3, d4mgha5, d4mgha7 automated match to d3ujna4 complexed with act, adp, mg, mn, so4, xe |
PDB Entry: 4mgh (more details), 2.65 Å
SCOPe Domain Sequences for d4mgha4:
Sequence, based on SEQRES records: (download)
>d4mgha4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 99287]} ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt pkmtrdv
>d4mgha4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 99287]} ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv
Timeline for d4mgha4: