SCOPe 2.05: Domain d4mgha4: 4mgh A:430-616

Lineage for d4mgha4 (4mgh A:430-616)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (3 species)

7. Species Salmonella typhimurium [TaxId:99287] [229692] (1 PDB entry)

8. Domain d4mgha4: 4mgh A:430-616 [229693]
   Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha3, d4mgha5, d4mgha7
   automated match to d3ujna4
   complexed with act, adp, mg, mn, so4, xe

Details for d4mgha4

PDB Entry: 4mgh, 2.65 Å

PDB Description: Importance of Hydrophobic Cavities in Allosteric Regulation of Formylglycinamide Synthetase: Insight from Xenon Trapping and Statistical Coupling Analysis

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d4mgha4:

Sequence, based on SEQRES records:

>d4mgha4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 99287]}
ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw
qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe
ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt
pkmtrdv

Sequence, based on observed residues (ATOM records):

>d4mgha4 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium [TaxId: 99287]}
ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl
snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck
rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv

Timeline for d4mgha4:

• d4mgha4 first appeared in SCOPe 2.03
  
• d4mgha4 appears in SCOPe 2.04
  
• d4mgha4 appears in SCOPe 2.06
  
• d4mgha4 appears in the current release, SCOPe 2.08