| Class b: All beta proteins [48724] (176 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species) phage-borne toxin; bacteriophages H30 and H19B |
| Species Escherichia coli [TaxId:562] [50211] (14 PDB entries) |
| Domain d4m1uc_: 4m1u C: [229134] Other proteins in same PDB: d4m1ua_ automated match to d1r4pb_ complexed with 1ps |
PDB Entry: 4m1u (more details), 1.56 Å
SCOPe Domain Sequences for d4m1uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m1uc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd
Timeline for d4m1uc_: