Lineage for d4m1ub_ (4m1u B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540595Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1540602Species Escherichia coli [TaxId:562] [50211] (14 PDB entries)
  8. 1540618Domain d4m1ub_: 4m1u B: [229130]
    Other proteins in same PDB: d4m1ua_
    automated match to d1r4pb_
    complexed with 1ps

Details for d4m1ub_

PDB Entry: 4m1u (more details), 1.56 Å

PDB Description: the crystal structure of stx2 and a disaccharide ligand
PDB Compounds: (B:) Shiga toxin 2 B subunit

SCOPe Domain Sequences for d4m1ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1ub_ b.40.2.1 (B:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d4m1ub_:

Click to download the PDB-style file with coordinates for d4m1ub_.
(The format of our PDB-style files is described here.)

Timeline for d4m1ub_: