SCOPe 2.05: Domain d4m1uc_: 4m1u C:

Lineage for d4m1uc_ (4m1u C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (14 PDB entries)

8. Domain d4m1uc_: 4m1u C: [229134]
   Other proteins in same PDB: d4m1ua_
   automated match to d1r4pb_
   complexed with 1ps

Details for d4m1uc_

PDB Entry: 4m1u, 1.56 Å

PDB Description: the crystal structure of stx2 and a disaccharide ligand

PDB Compounds: (C:) Shiga toxin 2 B subunit

SCOPe Domain Sequences for d4m1uc_:

Sequence; same for both SEQRES and ATOM records:

>d4m1uc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
gfaevqfnnd

Timeline for d4m1uc_:

• d4m1uc_ first appeared in SCOPe 2.03
  
• d4m1uc_ appears in SCOPe 2.04
  
• d4m1uc_ appears in SCOPe 2.06
  
• d4m1uc_ appears in the current release, SCOPe 2.08