SCOP 1.63: Domain d1azbb_: 1azb B:

Lineage for d1azbb_ (1azb B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)

8. Domain d1azbb_: 1azb B: [22912]
   complexed with cu, so4

Details for d1azbb_

PDB Entry: 1azb, 2.2 Å

PDB Description: structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution

SCOP Domain Sequences for d1azbb_:

Sequence; same for both SEQRES and ATOM records:

>d1azbb_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans}
aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn

Timeline for d1azbb_:

• d1azbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1azbb_ appears in SCOP 1.61
  
• d1azbb_ appears in SCOP 1.65
  
• d1azbb_ appears in the current release, SCOPe 2.08