Lineage for d1azbb_ (1azb B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770478Protein Azurin [49530] (6 species)
  7. 2770479Species Alcaligenes denitrificans [TaxId:32002] [49531] (8 PDB entries)
  8. 2770493Domain d1azbb_: 1azb B: [22912]
    complexed with cu, so4

Details for d1azbb_

PDB Entry: 1azb (more details), 2.2 Å

PDB Description: structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d1azbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azbb_ b.6.1.1 (B:) Azurin {Alcaligenes denitrificans [TaxId: 32002]}
aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
mkgtlklsn

SCOPe Domain Coordinates for d1azbb_:

Click to download the PDB-style file with coordinates for d1azbb_.
(The format of our PDB-style files is described here.)

Timeline for d1azbb_: