| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
| Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
| Protein automated matches [227065] (2 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228797] (1 PDB entry) |
| Domain d4lpab_: 4lpa B: [228799] automated match to d1qb3a_ |
PDB Entry: 4lpa (more details), 2.9 Å
SCOPe Domain Sequences for d4lpab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpab_ d.97.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechapephillfkrplnyeaelraaipitpt
Timeline for d4lpab_: