Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
Protein automated matches [227065] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228797] (1 PDB entry) |
Domain d4lpab1: 4lpa B:7-113 [228799] Other proteins in same PDB: d4lpaa2, d4lpab2, d4lpac2, d4lpad2 automated match to d1qb3a_ |
PDB Entry: 4lpa (more details), 2.9 Å
SCOPe Domain Sequences for d4lpab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpab1 d.97.1.1 (B:7-113) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl riltedewrglgitqslgwehyechapephillfkrplnyeaelraa
Timeline for d4lpab1: