SCOPe 2.04: Domain d4lpad_: 4lpa D:

Lineage for d4lpad_ (4lpa D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
   can form strand-exchange dimers

4. Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family)

5. Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)

6. Protein automated matches [227065] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228797] (1 PDB entry)

8. Domain d4lpad_: 4lpa D: [228798]
   automated match to d1qb3a_

Details for d4lpad_

PDB Entry: 4lpa, 2.9 Å

PDB Description: crystal structure of a cdc6 phosphopeptide in complex with cks1

PDB Compounds: (D:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d4lpad_:

Sequence; same for both SEQRES and ATOM records:

>d4lpad_ d.97.1.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechapephillfkrplnyeaelraaipitpt

Timeline for d4lpad_:

• d4lpad_ first appeared in SCOPe 2.03
  
• d4lpad_ appears in SCOPe 2.05
  
• d4lpad_ appears in the current release, SCOPe 2.08, called d4lpad1