| Class b: All beta proteins [48724] (177 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries) |
| Domain d4cc4d_: 4cc4 D: [228584] Other proteins in same PDB: d4cc4a1, d4cc4a2, d4cc4a3, d4cc4b2, d4cc4b3, d4cc4c1, d4cc4c2, d4cc4c3, d4cc4c4, d4cc4e1, d4cc4e2, d4cc4f2 automated match to d2xmfa_ complexed with cl, gol, pe4, po4, so4 |
PDB Entry: 4cc4 (more details), 2.6 Å
SCOPe Domain Sequences for d4cc4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cc4d_ b.34.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsnyirkt
eyt
Timeline for d4cc4d_: