PDB entry 4cc4

View 4cc4 on RCSB PDB site
Description: Complex of InlC of Listeria monocytogenes and human Tuba C-terminal SH3 domain
Class: cell invasion
Keywords: cell invasion, bacterial infection, pathogenesis, listerial cell-cell spread, virulence factor, protein-protein interactions, leucine-rich repeat, src homology 3 domain, disruption of cortical tension, cell membrane protrusions
Deposited on 2013-10-17, released 2013-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.19914
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inlc protein
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71451 (2-264)
      • expression tag (0-1)
      • engineered mutation (213-214)
    Domains in SCOPe 2.06: d4cc4a1, d4cc4a2, d4cc4a3
  • Chain 'B':
    Compound: Dynamin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XZF7 (2-66)
      • expression tag (0-1)
      • expression tag (67)
    Domains in SCOPe 2.06: d4cc4b1, d4cc4b2, d4cc4b3
  • Chain 'C':
    Compound: inlc protein
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71451 (2-264)
      • expression tag (1)
      • engineered mutation (213-214)
      • expression tag (265)
    Domains in SCOPe 2.06: d4cc4c1, d4cc4c2, d4cc4c3, d4cc4c4
  • Chain 'D':
    Compound: Dynamin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cc4d_
  • Chain 'E':
    Compound: inlc protein
    Species: LISTERIA MONOCYTOGENES EGD-E [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71451 (2-264)
      • engineered mutation (213-214)
    Domains in SCOPe 2.06: d4cc4e1, d4cc4e2
  • Chain 'F':
    Compound: Dynamin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6XZF7 (2-66)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d4cc4f1, d4cc4f2
  • Heterogens: GOL, CL, PE4, SO4, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cc4A (A:)
    asesiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslag
    mqfftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnel
    rdtdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwid
    ltgqkcvnepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsy
    kfseyinvgeteaifdgtvtqpiknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cc4A (A:)
    asesiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslag
    mqfftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnel
    rdtdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwid
    ltgqkcvnepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsy
    kfseyinvgeteaifdgtvtqpikn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4cc4B (B:)
    gpegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsny
    irkteyta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cc4C (C:)
    asesiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslag
    mqfftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnel
    rdtdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwid
    ltgqkcvnepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsy
    kfseyinvgeteaifdgtvtqpiknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cc4C (C:)
    sesiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagm
    qfftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelr
    dtdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidl
    tgqkcvnepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsyk
    fseyinvgeteaifdgtvtqpiknk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cc4D (D:)
    gpegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsny
    irkteyta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cc4D (D:)
    nqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsnyirkt
    eyt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4cc4E (E:)
    asesiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslag
    mqfftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnel
    rdtdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwid
    ltgqkcvnepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsy
    kfseyinvgeteaifdgtvtqpiknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cc4E (E:)
    esiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagmq
    fftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelrd
    tdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidlt
    gqkcvnepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsykf
    seyinvgeteaifdgtvtqpikn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4cc4F (F:)
    gpegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsny
    irkteyta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cc4F (F:)
    gpegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsny
    irkteyt